PDB entry 1te1

View 1te1 on RCSB PDB site
Description: Crystal structure of family 11 xylanase in complex with inhibitor (XIP-I)
Class: hydrolase inhibitor/hydrolase
Keywords: BETA/ALPHA BARREL (XIP-I) and BETA JELLY ROLL (GH11), HYDROLASE INHIBITOR-HYDROLASE COMPLEX
Deposited on 2004-05-24, released 2004-07-20
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.213
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Xylanase Inhibitor Protein I
    Species: Triticum aestivum [TaxId:4565]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8L5C6 (0-273)
      • see remark 999 (36)
      • see remark 999 (183)
    Domains in SCOPe 2.03: d1te1a_
  • Chain 'B':
    Compound: endo-1,4-xylanase
    Species: Penicillium funiculosum [TaxId:28572]
    Gene: XYNC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1te1b_
  • Heterogens: NAG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1te1A (A:)
    aggktgqvtvfwgrnkaegslreacdsgmytmvtmsfldvfgangkyhldlsghdlssvg
    adikhcqskgvpvslsiggygtgyslpsnrsaldlfdhlwnsyfggskpsvprpfgdawl
    dgvdlflehgtpadrydvlalelakhnirggpgkplhltatvrcgyppaahvgralatgi
    fervhvrtyesdkwcnqnlgwegswdkwtaaypatrfyvgltaddkshqwvhpknvyygv
    apvaqkkdnyggimlwdryfdkqtnysslikyya
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1te1B (B:)
    qsittsqtgtnngyyysfwtngggevtytngdngeysvtwvdcgdftsgkgwnpanaqtv
    tysgefnpsgnaylavygwttdplveyyilesygtynpssgltslgqvtsdggtydiyst
    qrvnqpsiegtstfnqywsvrtekrvggtvttanhfaawkalglemgtynymivstegye
    ssgsstitvs