PDB entry 1te1

View 1te1 on RCSB PDB site
Description: crystal structure of family 11 xylanase in complex with inhibitor (xip-i)
Deposited on 2004-05-24, released 2004-07-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-31, with a file datestamp of 2004-08-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.213
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1te1a_
  • Chain 'B':
    Domains in SCOP 1.69: d1te1b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1te1A (A:)
    aggktgqvtvfwgrnkaegslreacdsgmytmvtmsfldvfgangkyhldlsghdlssvg
    adikhcqskgvpvslsiggygtgyslpsnrsaldlfdhlwnsyfggskpsvprpfgdawl
    dgvdlflehgtpadrydvlalelakhnirggpgkplhltatvrcgyppaahvgralatgi
    fervhvrtyesdkwcnqnlgwegswdkwtaaypatrfyvgltaddkshqwvhpknvyygv
    apvaqkkdnyggimlwdryfdkqtnysslikyya
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1te1B (B:)
    qsittsqtgtnngyyysfwtngggevtytngdngeysvtwvdcgdftsgkgwnpanaqtv
    tysgefnpsgnaylavygwttdplveyyilesygtynpssgltslgqvtsdggtydiyst
    qrvnqpsiegtstfnqywsvrtekrvggtvttanhfaawkalglemgtynymivstegye
    ssgsstitvs