PDB entry 1tdw

View 1tdw on RCSB PDB site
Description: crystal structure of double truncated human phenylalanine hydroxylase bh4-responsive pku mutant a313t.
Deposited on 2004-05-24, released 2004-11-30
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-30, with a file datestamp of 2004-11-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1tdwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tdwA (A:)
    tvpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpipr
    veymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqt
    ctgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsd
    rsfaqfsqeiglaslgtpdeyieklatiywftvefglckqgdsikaygagllssfgelqy
    clsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydp
    ytqrievl