PDB entry 1tdv

View 1tdv on RCSB PDB site
Description: Non-specific binding to phospholipase A2:Crystal structure of the complex of PLA2 with a designed peptide Tyr-Trp-Ala-Ala-Ala-Ala at 1.7A resolution
Deposited on 2004-05-24, released 2004-06-08
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-08, with a file datestamp of 2004-06-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.18
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.71: d1tdva_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tdvA (A:)
  sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
  sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
  c