PDB entry 1tdr

View 1tdr on RCSB PDB site
Description: expression, characterization, and crystallographic analysis of telluromethionyl dihydrofolate reductase
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 1995-04-13, released 1995-07-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.124
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: telluromethionyl dihydrofolate reductase
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00379 (0-158)
    • conflict (36)
    • conflict (153)
  Domains in SCOPe 2.08: d1tdra_
• Chain 'B':
  Compound: telluromethionyl dihydrofolate reductase
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00379 (0-158)
    • conflict (36)
    • conflict (153)
  Domains in SCOPe 2.08: d1tdrb_
• Heterogens: CL, CA, MTX, TE, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tdrA (A:)
  misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
  ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
  gdthfpdyepddwesvfsefhdadaqnshsycfkilerr
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tdrB (B:)
  misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
  ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
  gdthfpdyepddwesvfsefhdadaqnshsycfkilerr