PDB entry 1tdp

View 1tdp on RCSB PDB site
Description: NMR solution structure of the carnobacteriocin B2 immunity protein
Class: antimicrobial protein
Keywords: four-helix bundle, ANTIMICROBIAL PROTEIN
Deposited on 2004-05-23, released 2004-09-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carnobacteriocin B2 immunity protein
    Species: Carnobacterium maltaromaticum [TaxId:2751]
    Gene: cbiB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tdpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tdpA (A:)
    mdiksqtlylnlseaykdpevkaneflsklvvqcagkltasnsensyievisllsrgiss
    yylshkriipssmltiytqiqkdikngnidteklrkyeiakglmsvpyiyf