PDB entry 1tdo

View 1tdo on RCSB PDB site
Description: l-amino acid oxidae from agkistrodon halys in complex with l- phenylalanine
Deposited on 2004-05-23, released 2004-06-22
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-22, with a file datestamp of 2004-06-22.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.179
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tdoA (A:)
    andrnpleecfretdyeefleiarnglkatsnpkhvvvvgagmsglsaayvlsgaghqvt
    vleaseraggrvrtyrndkedwyanlgpmrlpekhrivreyirkfglqlnefsqendnaw
    yfiknirkrvgevkkdpgvlkypvkpseegksagqlyeeslgkvveelkrtncsyilnky
    dtystkeyllkegnlspgavdmigdlmnedsgyyvsfpeslrhddifayekrfdeivggm
    dklptsmyraieekvhlnaqvikiqknaekvtvvyqtpakemasvtadyvivcttsratr
    rikfepplppkkahalrsvhyrsgtkifltctkkfwedegihggksttdlpsrfiyypnh
    nftsgvgviiaygigddanffqaldfkdcadivindlslihqlpreeiqtfcypsmiqkw
    sldkyamggittftpyqfqhfsesltasvdriyfagehtaeahgwidstiksglraardv
    nraseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tdoA (A:)
    drnpleecfretdyeefleiarnglkatsnpkhvvvvgagmsglsaayvlsgaghqvtvl
    easeraggrvrtyrndkedwyanlgpmrlpekhrivreyirkfglqlnefsqendnawyf
    iknirkrvgevkkdpgvlkypvkpseegksagqlyeeslgkvveelkrtncsyilnkydt
    ystkeyllkegnlspgavdmigdlmnedsgyyvsfpeslrhddifayekrfdeivggmdk
    lptsmyraieekvhlnaqvikiqknaekvtvvyqtpakemasvtadyvivcttsratrri
    kfepplppkkahalrsvhyrsgtkifltctkkfwedegihggksttdlpsrfiyypnhnf
    tsgvgviiaygigddanffqaldfkdcadivindlslihqlpreeiqtfcypsmiqkwsl
    dkyamggittftpyqfqhfsesltasvdriyfagehtaeahgwidstiksglraardvnr
    aseq