PDB entry 1tdn

View 1tdn on RCSB PDB site
Description: L-amino acid oxidase from Agkistrodon halys in complex with L-leucine
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2004-05-23, released 2004-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.192
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-amino acid oxidase
    Species: Gloydius halys [TaxId:8714]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tdna1, d1tdna2
  • Heterogens: NAG, NDG, FAD, LEU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tdnA (A:)
    andrnpleecfretdyeefleiarnglkatsnpkhvvvvgagmsglsaayvlsgaghqvt
    vleaseraggrvrtyrndkedwyanlgpmrlpekhrivreyirkfglqlnefsqendnaw
    yfiknirkrvgevkkdpgvlkypvkpseegksagqlyeeslgkvveelkrtncsyilnky
    dtystkeyllkegnlspgavdmigdlmnedsgyyvsfpeslrhddifayekrfdeivggm
    dklptsmyraieekvhlnaqvikiqknaekvtvvyqtpakemasvtadyvivcttsratr
    rikfepplppkkahalrsvhyrsgtkifltctkkfwedegihggksttdlpsrfiyypnh
    nftsgvgviiaygigddanffqaldfkdcadivindlslihqlpreeiqtfcypsmiqkw
    sldkyamggittftpyqfqhfsesltasvdriyfagehtaeahgwidstiksglraardv
    nraseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tdnA (A:)
    drnpleecfretdyeefleiarnglkatsnpkhvvvvgagmsglsaayvlsgaghqvtvl
    easeraggrvrtyrndkedwyanlgpmrlpekhrivreyirkfglqlnefsqendnawyf
    iknirkrvgevkkdpgvlkypvkpseegksagqlyeeslgkvveelkrtncsyilnkydt
    ystkeyllkegnlspgavdmigdlmnedsgyyvsfpeslrhddifayekrfdeivggmdk
    lptsmyraieekvhlnaqvikiqknaekvtvvyqtpakemasvtadyvivcttsratrri
    kfepplppkkahalrsvhyrsgtkifltctkkfwedegihggksttdlpsrfiyypnhnf
    tsgvgviiaygigddanffqaldfkdcadivindlslihqlpreeiqtfcypsmiqkwsl
    dkyamggittftpyqfqhfsesltasvdriyfagehtaeahgwidstiksglraardvnr
    aseq