PDB entry 1tdk

View 1tdk on RCSB PDB site
Description: l-amino acid oxidase from agkistrodon halys in complex with suicide substrate l-vinylglycine
Deposited on 2004-05-22, released 2004-06-22
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-22, with a file datestamp of 2004-06-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.192
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tdkA (A:)
    andrnpleecfretdyeefleiarnglkatsnpkhvvvvgagmsglsaayvlsgaghqvt
    vleaseraggrvrtyrndkedwyanlgpmrlpekhrivreyirkfglqlnefsqendnaw
    yfiknirkrvgevkkdpgvlkypvkpseegksagqlyeeslgkvveelkrtncsyilnky
    dtystkeyllkegnlspgavdmigdlmnedsgyyvsfpeslrhddifayekrfdeivggm
    dklptsmyraieekvhlnaqvikiqknaekvtvvyqtpakemasvtadyvivcttsratr
    rikfepplppkkahalrsvhyrsgtkifltctkkfwedegihggksttdlpsrfiyypnh
    nftsgvgviiaygigddanffqaldfkdcadivindlslihqlpreeiqtfcypsmiqkw
    sldkyamggittftpyqfqhfsesltasvdriyfagehtaeahgwidstiksglraardv
    nraseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tdkA (A:)
    drnpleecfretdyeefleiarnglkatsnpkhvvvvgagmsglsaayvlsgaghqvtvl
    easeraggrvrtyrndkedwyanlgpmrlpekhrivreyirkfglqlnefsqendnawyf
    iknirkrvgevkkdpgvlkypvkpseegksagqlyeeslgkvveelkrtncsyilnkydt
    ystkeyllkegnlspgavdmigdlmnedsgyyvsfpeslrhddifayekrfdeivggmdk
    lptsmyraieekvhlnaqvikiqknaekvtvvyqtpakemasvtadyvivcttsratrri
    kfepplppkkahalrsvhyrsgtkifltctkkfwedegihggksttdlpsrfiyypnhnf
    tsgvgviiaygigddanffqaldfkdcadivindlslihqlpreeiqtfcypsmiqkwsl
    dkyamggittftpyqfqhfsesltasvdriyfagehtaeahgwidstiksglraardvnr
    aseq