PDB entry 1tdh

View 1tdh on RCSB PDB site
Description: Crystal structure of human endonuclease VIII-like 1 (NEIL1)
Class: hydrolase
Keywords: helix two turns helix, zinc-less finger, HYDROLASE
Deposited on 2004-05-22, released 2004-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.194
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nei endonuclease VIII-like 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96FI4
      • see remark 999 (146)
      • see remark 999 (241)
    Domains in SCOPe 2.07: d1tdha1, d1tdha2, d1tdha3
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tdhA (A:)
    mpegpelhlasqfvneacralvfggcvekssvsrnpevpfessayrisasargkelrlil
    splpgaqpqqeplalvfrfgmsgsfqlvpreelprhahlrfytappgprlalcfvdirrf
    grwdlggkwqpgrgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylra
    eilyrlkippfekarsvlealqqhrpspeltlsqkirtklqnpdllelchsvpkevvqlg
    grgygsesgeedfaafrawlrcygmpgmsslqdrhgrtiwfqgdpgplapkgrksrkkks
    katqlspedrvedalppskapsrtrrakrdlpkrkgrqaasghcrprkvkadipslepeg
    tsas
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tdhA (A:)
    pegpelhlasqfvneacralvfggcvekssvsrnpevpfessayrisasargkelrlils
    plpgaqpqqeplalvfrfgmsgsfqlvpreelprhahlrfytappgprlalcfvdirrfg
    rwdlggkwqpgrgpcvlqeyqqfresvlrnladkafdrpicealldqrffngignylrae
    ilyrlkippfekarsvlealqpeltlsqkirtklqnpdllelchsvpkevvqlggrgygs
    esgeedfaafrawlrcygmpgmsslqdrhgrtiwfqgdpgplap