PDB entry 1tdg

View 1tdg on RCSB PDB site
Description: Complex of S130G SHV-1 beta-lactamase with tazobactam
Class: hydrolase
Keywords: S130G SHV-1 class A beta-lactamase, penicillinase, beta-lactam hydrolase, detergent binding, inhibitor complex, tazobactam, aldehyde, cymal-6, hydrolase
Deposited on 2004-05-21, released 2004-11-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Beta-lactamase SHV-1
  Species: Klebsiella pneumoniae [TaxId:573]
  Gene: bla
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14557 (0-264)
    • engineered (104)
  Domains in SCOPe 2.08: d1tdga_
• Heterogens: MA4, TBE, MDD, MRD, MPD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tdgA (A:)
  spqpleqiklsesqlsgrvgmiemdlasgrtltawraderfpmmstfkvvlcgavlarvd
  agdeqlerkihyrqqdlvdyspvsekhladgmtvgelcaaaitmgdnsaanlllatvggp
  agltaflrqigdnvtrldrwetelnealpgdardtttpasmaatlrklltsqrlsarsqr
  qllqwmvddrvagplirsvlpagwfiadktgagergargivallgpnnkaerivviylrd
  tpasmaernqqiagigaaliehwqr