PDB entry 1td9

View 1td9 on RCSB PDB site
Description: Crystal Structure of a Phosphotransacetylase from Bacillus subtilis
Class: transferase
Keywords: structural genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, TRANSFERASE
Deposited on 2004-05-21, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.268
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphate acetyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PTA, IPA-88D, BSU37660
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39646 (7-328)
      • initiating met (6)
    Domains in SCOPe 2.07: d1td9a_
  • Chain 'B':
    Compound: Phosphate acetyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PTA, IPA-88D, BSU37660
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39646 (7-328)
      • cloning artifact (5)
      • initiating met (6)
    Domains in SCOPe 2.07: d1td9b1, d1td9b2
  • Chain 'C':
    Compound: Phosphate acetyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PTA, IPA-88D, BSU37660
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39646 (7-328)
      • initiating met (6)
    Domains in SCOPe 2.07: d1td9c_
  • Chain 'D':
    Compound: Phosphate acetyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PTA, IPA-88D, BSU37660
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39646 (7-328)
      • cloning artifact (4-5)
      • initiating met (6)
    Domains in SCOPe 2.07: d1td9d1, d1td9d2
  • Chain 'E':
    Compound: Phosphate acetyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PTA, IPA-88D, BSU37660
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39646 (7-328)
      • initiating met (6)
    Domains in SCOPe 2.07: d1td9e_
  • Chain 'F':
    Compound: Phosphate acetyltransferase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PTA, IPA-88D, BSU37660
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39646 (7-328)
      • initiating met (6)
    Domains in SCOPe 2.07: d1td9f_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1td9A (A:)
    ggggggmadlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiq
    akakelnltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvy
    kgladglvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapd
    sqdlaeiaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltld
    gefqfdaafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqg
    lnmpvndlsrgcnaedvynlalitaaqal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td9A (A:)
    madlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakakel
    nltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykgladg
    lvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapdsqdlae
    iaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltldgefqfd
    aafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqglnmpvn
    dlsrgcnaedvynlalitaaqal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1td9B (B:)
    ggggggmadlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiq
    akakelnltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvy
    kgladglvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapd
    sqdlaeiaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltld
    gefqfdaafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqg
    lnmpvndlsrgcnaedvynlalitaaqal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td9B (B:)
    gmadlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakake
    lnltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykglad
    glvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapdsqdla
    eiaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltldgefqf
    daafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqglnmpv
    ndlsrgcnaedvynlalitaaqal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1td9C (C:)
    ggggggmadlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiq
    akakelnltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvy
    kgladglvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapd
    sqdlaeiaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltld
    gefqfdaafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqg
    lnmpvndlsrgcnaedvynlalitaaqal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td9C (C:)
    madlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakakel
    nltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykgladg
    lvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapdsqdlae
    iaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltldgefqfd
    aafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqglnmpvn
    dlsrgcnaedvynlalitaaqal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1td9D (D:)
    ggggggmadlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiq
    akakelnltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvy
    kgladglvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapd
    sqdlaeiaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltld
    gefqfdaafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqg
    lnmpvndlsrgcnaedvynlalitaaqal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td9D (D:)
    ggmadlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakak
    elnltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykgla
    dglvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapdsqdl
    aeiaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltldgefq
    fdaafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqglnmp
    vndlsrgcnaedvynlalitaaqal
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1td9E (E:)
    ggggggmadlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiq
    akakelnltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvy
    kgladglvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapd
    sqdlaeiaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltld
    gefqfdaafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqg
    lnmpvndlsrgcnaedvynlalitaaqal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td9E (E:)
    madlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakakel
    nltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykgladg
    lvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapdsqdlae
    iaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltldgefqfd
    aafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqglnmpvn
    dlsrgcnaedvynlalitaaqal
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1td9F (F:)
    ggggggmadlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiq
    akakelnltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvy
    kgladglvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapd
    sqdlaeiaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltld
    gefqfdaafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqg
    lnmpvndlsrgcnaedvynlalitaaqal
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td9F (F:)
    madlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakakel
    nltlggvkiydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykgladg
    lvsgaahstadtvrpalqiiktkegvkktsgvfimargeeqyvfadcainiapdsqdlae
    iaiesantakmfdieprvamlsfstkgsaksdetekvadavkiakekapeltldgefqfd
    aafvpsvaekkapdseikgdanvfvfpsleagnigykiaqrlgnfeavgpilqglnmpvn
    dlsrgcnaedvynlalitaaqal