PDB entry 1td7

View 1td7 on RCSB PDB site
Description: Interactions of a specific non-steroidal anti-inflammatory drug (NSAID) with group I phospholipase A2 (PLA2): Crystal structure of the complex formed between PLA2 and niflumic acid at 2.5 A resolution
Deposited on 2004-05-21, released 2004-06-08
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-08, with a file datestamp of 2004-06-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.195
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1td7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1td7A (A:)
    nlyqfknmiqctvpsrswqdfadygcycgkggsgtpvddldrccqvhdncyneaenisgc
    rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapyndanynidlkarcn