PDB entry 1td6

View 1td6 on RCSB PDB site
Description: Crystal structure of the conserved hypothetical protein MP506/MPN330 (gi: 1674200)from Mycoplasma pneumoniae
Class: structural genomics, unknown function
Keywords: ALPHA HELICAL, STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Berkeley Structural Genomics Center, BSGC, UNKNOWN FUNCTION
Deposited on 2004-05-21, released 2004-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.244
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein MG237 homolog
    Species: Mycoplasma pneumoniae [TaxId:2104]
    Gene: MPN330, MP506
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1td6a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1td6A (A:)
    mhhhhhhgggggminkpnqfvnhlsalkkhfasykelreafndyhkhngdelttfflhqf
    dkvmelvkqkdfktaqsrceeelaapylpkplvsffqsllqlvnhdlleqqnaalaslpa
    akiielvlqdypnklnmihyllpktkafvkphllqrlqfvltdsellelkrfsffqalnq
    ipgfqgeqveyfnsklkqkftltlgefeiaqqpdakayfeqlitqiqqlflkepvnaefa
    neiidaflvsyfplhppvplaqlaakiyeyvsqivlneavnlkdeliklivhtlyeqldr
    pvgden
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td6A (A:)
    pnqfvnhlsalkkhfasykelreafndyhkhngdelttfflhqfdkvmelvkqkdfktaq
    srceeelaapylpkplvsffqsllqlvnhdlleqqnaalaslpaakiielvlqdypnkln
    mihyllpktkafvkphllqrlqfvltdsellelkrfsffqalnqipgfqgeqveyfnskl
    kqkftltlgefeiaqqpdakayfeqlitqiqqlflkepvnaefaneiidaflvsyfplhp
    pvplaqlaakiyeyvsqivlneavnlkdeliklivhtlyeqldrpv