PDB entry 1td5

View 1td5 on RCSB PDB site
Description: Crystal Structure of the Ligand Binding Domain of E. coli IclR.
Class: transcription
Keywords: MIDWEST CENTER FOR STRUCTURAL GENOMICS, ALPHA/BETA DOMAIN,LIGAND BINDING DOMAIN, TRANSCRIPTION REGULATOR, PSI, Protein Structure Initiative, MCSG
Deposited on 2004-05-21, released 2004-07-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetate operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: ICLR, B4018
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16528 (23-End)
      • cloning artifact (20-22)
      • modified residue (38)
      • modified residue (47)
      • modified residue (69)
      • modified residue (71)
      • modified residue (81)
      • modified residue (183)
      • modified residue (198)
    Domains in SCOPe 2.05: d1td5a_
  • Chain 'B':
    Compound: Acetate operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: ICLR, B4018
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16528 (23-End)
      • cloning artifact (20-22)
      • modified residue (38)
      • modified residue (47)
      • modified residue (69)
      • modified residue (71)
      • modified residue (81)
      • modified residue (183)
      • modified residue (198)
    Domains in SCOPe 2.05: d1td5b_
  • Chain 'C':
    Compound: Acetate operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: ICLR, B4018
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16528 (23-End)
      • cloning artifact (21-22)
      • modified residue (38)
      • modified residue (47)
      • modified residue (69)
      • modified residue (71)
      • modified residue (81)
      • modified residue (183)
      • modified residue (198)
    Domains in SCOPe 2.05: d1td5c_
  • Chain 'D':
    Compound: Acetate operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: ICLR, B4018
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16528 (23-199)
      • cloning artifact (20-22)
      • modified residue (38)
      • modified residue (47)
      • modified residue (69)
      • modified residue (71)
      • modified residue (81)
      • modified residue (183)
      • modified residue (198)
    Domains in SCOPe 2.05: d1td5d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1td5A (A:)
    mgsshhhhhhssgrenlyfqghmsrnllaivhpilrnlmeesgetvnmavldqsdheaii
    idqvqcthlmrmsapiggklpmhasgagkaflaqlseeqvtkllhrkglhaythatlvsp
    vhlkedlaqtrkrgysfddeehalglrclaacifdehrepfaaisisgpisritddrvte
    fgamvikaakevtlayggmrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td5A (A:)
    ghmsrnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggkl
    pmhasgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfdde
    ehalglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1td5B (B:)
    mgsshhhhhhssgrenlyfqghmsrnllaivhpilrnlmeesgetvnmavldqsdheaii
    idqvqcthlmrmsapiggklpmhasgagkaflaqlseeqvtkllhrkglhaythatlvsp
    vhlkedlaqtrkrgysfddeehalglrclaacifdehrepfaaisisgpisritddrvte
    fgamvikaakevtlayggmrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td5B (B:)
    ghmsrnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggkl
    pmhasgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfdde
    ehalglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1td5C (C:)
    mgsshhhhhhssgrenlyfqghmsrnllaivhpilrnlmeesgetvnmavldqsdheaii
    idqvqcthlmrmsapiggklpmhasgagkaflaqlseeqvtkllhrkglhaythatlvsp
    vhlkedlaqtrkrgysfddeehalglrclaacifdehrepfaaisisgpisritddrvte
    fgamvikaakevtlayggmrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td5C (C:)
    hmsrnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggklp
    mhasgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfddee
    halglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1td5D (D:)
    mgsshhhhhhssgrenlyfqghmsrnllaivhpilrnlmeesgetvnmavldqsdheaii
    idqvqcthlmrmsapiggklpmhasgagkaflaqlseeqvtkllhrkglhaythatlvsp
    vhlkedlaqtrkrgysfddeehalglrclaacifdehrepfaaisisgpisritddrvte
    fgamvikaakevtlayggmrgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td5D (D:)
    ghmsrnllaivhpilrnlmeesgetvnmavldqsdheaiiidqvqcthlmrmsapiggkl
    pmhasgagkaflaqlseeqvtkllhrkglhaythatlvspvhlkedlaqtrkrgysfdde
    ehalglrclaacifdehrepfaaisisgpisritddrvtefgamvikaakevtlayggmr