PDB entry 1td4

View 1td4 on RCSB PDB site
Description: Crystal structure of VSHP_BPP21 in space group H3 with high resolution.
Class: Viral protein
Keywords: shp
Deposited on 2004-05-21, released 2004-11-02
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.138
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Head decoration protein
    Species: Bacteriophage P21
    Database cross-references and differences (RAF-indexed):
    • Uniprot P36275 (Start-114)
      • d-configuration (93)
    Domains in SCOP 1.73: d1td4a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1td4A (A:)
mvtktiteqraevrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkags
avgilvlplegtetaltyyksgtfateaihwpesvdehkkanafagsalshaalp

    Sequence, based on observed residues (ATOM records): (download) 
    >1td4A (A:)
vrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsavgilvlplegt
etaltyyksgtfateaihwpesvdehkkanafagsalshaalp