PDB entry 1td4

View 1td4 on RCSB PDB site
Description: Crystal structure of VSHP_BPP21 in space group H3 with high resolution.
Deposited on 2004-05-21, released 2004-11-02
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-02, with a file datestamp of 2004-11-02.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.138
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1td4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1td4A (A:)
    mvtktiteqraevrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkags
    avgilvlplegtetaltyyksgtfateaihwpesvdehkkanafagsalshaalp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td4A (A:)
    vrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsavgilvlplegt
    etaltyyksgtfateaihwpesvdehkkanafagsalshaalp