PDB entry 1td3

View 1td3 on RCSB PDB site
Description: crystal structure of vshp_bpp21 in space group c2
Deposited on 2004-05-21, released 2004-11-02
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-02, with a file datestamp of 2004-11-02.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.206
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1td3a_
  • Chain 'B':
    Domains in SCOP 1.71: d1td3b_
  • Chain 'C':
    Domains in SCOP 1.71: d1td3c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1td3A (A:)
    mvtktiteqraevrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkags
    avgilvlplegtetaltyyksgtfateaihwpesvdehkkanafagsalshaalp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td3A (A:)
    vrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsavgilvlplegt
    etaltyyksgtfateaihwpesvdehkkanafagsalshaalp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1td3B (B:)
    mvtktiteqraevrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkags
    avgilvlplegtetaltyyksgtfateaihwpesvdehkkanafagsalshaalp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td3B (B:)
    vrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsavgilvlplegt
    etaltyyksgtfateaihwpesvdehkkanafagsalshaalp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1td3C (C:)
    mvtktiteqraevrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkags
    avgilvlplegtetaltyyksgtfateaihwpesvdehkkanafagsalshaalp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td3C (C:)
    vrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsavgilvlplegt
    etaltyyksgtfateaihwpesvdehkkanafagsalshaalp