PDB entry 1td3

View 1td3 on RCSB PDB site
Description: Crystal structure of VSHP_BPP21 in space group C2
Class: Viral protein
Keywords: SHP, Viral protein
Deposited on 2004-05-21, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-22, with a file datestamp of 2017-02-17.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Head decoration protein
    Species: Enterobacteria phage lambda [TaxId:10711]
    Gene: shp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1td3a_
  • Chain 'B':
    Compound: Head decoration protein
    Species: Enterobacteria phage lambda [TaxId:10711]
    Gene: shp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1td3b_
  • Chain 'C':
    Compound: Head decoration protein
    Species: Enterobacteria phage lambda [TaxId:10711]
    Gene: shp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1td3c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1td3A (A:)
    mvtktiteqraevrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkags
    avgilvlplegtetaltyyksgtfateaihwpesvdehkkanafagsalshaalp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td3A (A:)
    vrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsavgilvlplegt
    etaltyyksgtfateaihwpesvdehkkanafagsalshaalp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1td3B (B:)
    mvtktiteqraevrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkags
    avgilvlplegtetaltyyksgtfateaihwpesvdehkkanafagsalshaalp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td3B (B:)
    vrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsavgilvlplegt
    etaltyyksgtfateaihwpesvdehkkanafagsalshaalp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1td3C (C:)
    mvtktiteqraevrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkags
    avgilvlplegtetaltyyksgtfateaihwpesvdehkkanafagsalshaalp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td3C (C:)
    vrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsavgilvlplegt
    etaltyyksgtfateaihwpesvdehkkanafagsalshaalp