PDB entry 1td2

View 1td2 on RCSB PDB site
Description: Crystal Structure of the PdxY Protein from Escherichia coli
Class: transferase
Keywords: Pyridoxal kinase, ribokinase family, kinase, phosphorylation, PdxY, transferase
Deposited on 2004-05-21, released 2004-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: 0.176
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyridoxamine kinase
    Species: Escherichia coli [TaxId:562]
    Gene: PDXY, B1636
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1td2a_
  • Chain 'B':
    Compound: Pyridoxamine kinase
    Species: Escherichia coli [TaxId:562]
    Gene: PDXY, B1636
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1td2b_
  • Heterogens: SO4, PXL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1td2A (A:)
    mmknilaiqshvvyghagnsaaefpmrrlganvwplntvqfsnhtqygkwtgcvmppshl
    teivqgiaaidklhtcdavlsgylgsaeqgehilgivrqvkaanpqakyfcdpvmghpek
    gcivapgvaefhvrhglpasdiiapnlveleilcehavnnveeavlaareliaqgpqivl
    vkhlaragysrdrfemllvtadeawhisrplvdfgmrqpvgvgdvtsglllvkllqgatl
    qealehvtaavyeimvttkamqeyelqvvaaqdriakpehyfsatkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1td2B (B:)
    mmknilaiqshvvyghagnsaaefpmrrlganvwplntvqfsnhtqygkwtgcvmppshl
    teivqgiaaidklhtcdavlsgylgsaeqgehilgivrqvkaanpqakyfcdpvmghpek
    gcivapgvaefhvrhglpasdiiapnlveleilcehavnnveeavlaareliaqgpqivl
    vkhlaragysrdrfemllvtadeawhisrplvdfgmrqpvgvgdvtsglllvkllqgatl
    qealehvtaavyeimvttkamqeyelqvvaaqdriakpehyfsatkl