PDB entry 1td0

View 1td0 on RCSB PDB site
Description: Viral capsid protein SHP at pH 5.5
Class: Viral protein
Keywords: SHP, Viral protein
Deposited on 2004-05-21, released 2004-11-02
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.229
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Head decoration protein
    Species: Enterobacteria phage P21 [TaxId:10711]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1td0a_
  • Chain 'B':
    Compound: Head decoration protein
    Species: Enterobacteria phage P21 [TaxId:10711]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1td0b_
  • Chain 'C':
    Compound: Head decoration protein
    Species: Enterobacteria phage P21 [TaxId:10711]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1td0c_
  • Chain 'D':
    Compound: Head decoration protein
    Species: Enterobacteria phage P21 [TaxId:10711]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1td0d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1td0A (A:)
    vtktiteqraevrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsa
    vgilvlplegtetaltyyksgtfateaihwpesvdehkkanafagsalshaalp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td0A (A:)
    evrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsavgilvlpleg
    tetaltyyksgtfateaihwpesvdehkkanafagsalshaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1td0B (B:)
    vtktiteqraevrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsa
    vgilvlplegtetaltyyksgtfateaihwpesvdehkkanafagsalshaalp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td0B (B:)
    evrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsavgilvlpleg
    tetaltyyksgtfateaihwpesvdehkkanafagsalshaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1td0C (C:)
    vtktiteqraevrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsa
    vgilvlplegtetaltyyksgtfateaihwpesvdehkkanafagsalshaalp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td0C (C:)
    vrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsavgilvlplegt
    etaltyyksgtfateaihwpesvdehkkanafagsalshaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1td0D (D:)
    vtktiteqraevrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsa
    vgilvlplegtetaltyyksgtfateaihwpesvdehkkanafagsalshaalp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1td0D (D:)
    evrifagndpahtatgssgissptpaltplmldeatgklvvwdgqkagsavgilvlpleg
    tetaltyyksgtfateaihwpesvdehkkanafagsalshaal