PDB entry 1tcx

View 1tcx on RCSB PDB site
Description: hiv triple mutant protease complexed with inhibitor sb203386
Class: hydrolase (acid protease)
Keywords: aids, polyprotein, hydrolase, aspartyl protease, endonuclease, RNA-directed DNA polymerase, acid protease, hydrolase (acid protease)
Deposited on 1996-06-05, released 1996-12-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.18
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HIV-1 PROTEASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • engineered (31)
      • engineered (46)
      • engineered (81)
    Domains in SCOPe 2.01: d1tcxa_
  • Chain 'B':
    Compound: hiv protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HIV-1 PROTEASE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04587 (0-98)
      • engineered (31)
      • engineered (46)
      • engineered (81)
    Domains in SCOPe 2.01: d1tcxb_
  • Heterogens: IM1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tcxA (A:)
    pqitlwqrplvtikiggqlkealldtgaddtileemslpgrwkpkmvggiggfikvrqyd
    qilieicghkaigtvlvgptpiniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tcxB (B:)
    pqitlwqrplvtikiggqlkealldtgaddtileemslpgrwkpkmvggiggfikvrqyd
    qilieicghkaigtvlvgptpiniigrnlltqigctlnf