PDB entry 1tcw

View 1tcw on RCSB PDB site
Description: siv protease complexed with inhibitor sb203386
Class: hydrolase (acid protease)
Keywords: aids, polyprotein, hydrolase, aspartyl protease, endonuclease, RNA-directed DNA polymerase, acid protease, hydrolase (acid protease)
Deposited on 1996-06-05, released 1996-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.197
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: siv protease
    Species: Simian immunodeficiency virus [TaxId:11723]
    Gene: SIV PROTEASE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tcwa_
  • Chain 'B':
    Compound: siv protease
    Species: Simian immunodeficiency virus [TaxId:11723]
    Gene: SIV PROTEASE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tcwb_
  • Heterogens: IM1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tcwA (A:)
    pqfslwrrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
    nvkievlgkrikgtimtgdtpinifgrnlltalgmslnl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tcwB (B:)
    pqfslwrrpvvtahiegqpvevlldtgaddsivtgielgphytpkivggiggfintkeyk
    nvkievlgkrikgtimtgdtpinifgrnlltalgmslnl