PDB entry 1tcr

View 1tcr on RCSB PDB site
Description: murine T-cell antigen receptor 2c clone
Class: receptor
Keywords: T-cell, receptor, transmembrane, glycoprotein
Deposited on 1996-09-12, released 1997-03-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.208
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha, beta T-cell receptor (vb8.2db2jb2.4cb2;va3ja58ca)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA25595 (0-201)
      • conflict (121)
      • conflict (157)
    Domains in SCOPe 2.03: d1tcra1, d1tcra2
  • Chain 'B':
    Compound: alpha, beta T-cell receptor (vb8.2db2jb2.4cb2;va3ja58ca)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB41230 (0-236)
      • conflict (95)
      • conflict (97-99)
      • conflict (102)
      • conflict (107)
    Domains in SCOPe 2.03: d1tcrb1, d1tcrb2
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tcrA (A:)
    qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqglqlllkyysgdpvvqgvn
    gfeaefsksnssfhlrkasvhwsdsavyfcavsgfasaltfgsgtkvivlpyiqnpepav
    yalkdprsqdstlclftdfdsqinvpktmesgtfitdatvldmkamdsksngaiawsnqt
    sftcqdifketnatypssdvpc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tcrB (B:)
    eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi
    pdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvledlrnvtppk
    vslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpqaykesnysy
    clssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaeawgradc