PDB entry 1tcp

View 1tcp on RCSB PDB site
Description: nmr structure determination of tick anticoagulant peptide (tap)
Deposited on 1994-10-31, released 1995-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1995-10-31, with a file datestamp of 1995-11-02.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1tcp__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tcp_ (-)
    ynrlcikprdwidecdsneggerayfrngkggcdsfwicpedhtgadyyssyrdcfnaci