PDB entry 1tco

View 1tco on RCSB PDB site
Description: ternary complex of a calcineurin a fragment, calcineurin b, fkbp12 and the immunosuppressant drug fk506 (tacrolimus)
Class: complex (hydrolase/isomerase)
Keywords: complex (hydrolase/isomerase), immunosuppressant
Deposited on 1996-08-21, released 1997-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.195
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine phosphatase b2
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tcoa_
  • Chain 'B':
    Compound: serine/threonine phosphatase b2
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tcob_
  • Chain 'C':
    Compound: fk506-binding protein
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62942 (0-106)
      • conflict (17)
    Domains in SCOPe 2.06: d1tcoc_
  • Heterogens: CA, ZN, FE, PO4, MYR, FK5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tcoA (A:)
    vkavpfppshrltakevfdndgkprvdilkahlmkegrleetvalriitegasilrqekn
    lldidapvtvcgdihgqffdlmklfevggspantrylflgdyvdrgyfsiecvlylwalk
    ilypktlfllrgnhecrhlteyftfkqeckikyservydacmdafdclplaalmnqqflc
    vhgglspeintlddirkldrfkeppaygpmcdilwsdpledfgnektqehfthntvrgcs
    yfysypavceflqhnnllsilraheaqdagyrmyrksqttgfpslitifsapnyldvynn
    kaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvtemlvnvlnicsddel
    gseedgfdgataaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tcoA (A:)
    vpfppshrltakevfdndgkprvdilkahlmkegrleetvalriitegasilrqeknlld
    idapvtvcgdihgqffdlmklfevggspantrylflgdyvdrgyfsiecvlylwalkily
    pktlfllrgnhecrhlteyftfkqeckikyservydacmdafdclplaalmnqqflcvhg
    glspeintlddirkldrfkeppaygpmcdilwsdpledfgnektqehfthntvrgcsyfy
    sypavceflqhnnllsilraheaqdagyrmyrksqttgfpslitifsapnyldvynnkaa
    vlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvtemlvnvlnic
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tcoB (B:)
    gneasyplemcshfdadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidi
    fdtdgngevdfkefiegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvg
    nnlkdtqlqqivdktiinadkdgdgrisfeefcavvggldihkkmvvdv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tcoC (C:)
    gvqvetispgdgrtfpkagqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
    egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle