PDB entry 1tcf

View 1tcf on RCSB PDB site
Description: crystal structure of calcium-saturated rabbit skeletal troponin c
Class: calcium-regulated muscle contraction
Keywords: muscle contraction, calcium-binding, troponin, e-f hand, open conformation regulatory domain, calcium-regulated muscle contraction
Deposited on 1998-03-04, released 1998-05-27
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.278
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: troponin c
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02586
      • engineered (97)
    Domains in SCOPe 2.04: d1tcfa_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tcfA (A:)
    tdqqaearsylseemiaefkaafdmfdadgggdisvkelgtvmrmlgqtptkeeldaiie
    evdedgsgtidfeeflvmmvrqmkedakgkseeelaelfrifdrnadgyidaeelaeifr
    asgehvtdeeieslmkdgdknndgridfdeflkmmegvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tcfA (A:)
    dqqaearsylseemiaefkaafdmfdadgggdisvkelgtvmrmlgqtptkeeldaiiee
    vdedgsgtidfeeflvmmvrqmkedakgkseeelaelfrifdrnadgyidaeelaeifra
    sgehvtdeeieslmkdgdknndgridfdeflkmmeg