PDB entry 1tcd

View 1tcd on RCSB PDB site
Description: trypanosoma cruzi triosephosphate isomerase
Class: isomerase
Keywords: isomerase, intramolecular oxidoreductase, glycolysis, isomerization between glyceraldehyde 3-phosphate and dihydroxyacetone, alpha-beta barrel
Deposited on 1998-01-29, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.191
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tcda_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tcdb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tcdA (A:)
    skpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkfq
    iaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaagf
    hvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatpq
    qaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkpe
    fveiieatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tcdA (A:)
    kpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkfqi
    aaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaagfh
    vivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatpqq
    aqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkpef
    veiieatk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tcdB (B:)
    skpqpiaaanwkcngsesllvplietlnaatfdhdvqcvvaptflhipmtkarltnpkfq
    iaaqnaitrsgaftgevslqilkdygiswvvlghserrlyygetneivaekvaqacaagf
    hvivcvgetneereagrtaavvltqlaavaqklskeawsrvviayepvwaigtgkvatpq
    qaqevhellrrwvrsklgtdiaaqlrilyggsvtaknartlyqmrdingflvggaslkpe
    fveiieatk