PDB entry 1tc8

View 1tc8 on RCSB PDB site
Description: Crystal structure of Krait-venom phospholipase A2 in a complex with a natural fatty acid tridecanoic acid
Class: toxin
Keywords: phospholipaseA2, complex, crystal, fatty acid, TOXIN
Deposited on 2004-05-21, released 2004-06-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.204
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Phospholipase A2 isoform 1
  Species: Bungarus caeruleus [TaxId:132961]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q6SLM2 (0-117)
  Domains in SCOPe 2.06: d1tc8a_
• Heterogens: NA, TDA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tc8A (A:)
  nlyqlmnmiqcantrtwpsytnygcycgkggsgtpvddldrccythdhcyndaknidgcn
  pvtktysytcteptitcndskdkcarfvcdcdrtaaicfakapyntsnvmirstnscq