PDB entry 1tc6

View 1tc6 on RCSB PDB site
Description: Ligand Induced Conformational Shift in the N-terminal Domain of GRP94, Open Conformation ADP-Complex
Class: chaperone
Keywords: GRP94, Hsp90, ADP, Bergerat, Chaperone, Endoplasmic Reticulum
Deposited on 2004-05-20, released 2004-08-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoplasmin
    Species: Canis lupus [TaxId:9615]
    Gene: TRA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41148 (Start-221)
      • see remark 999 (225)
    • Uniprot P41148 (226-235)
    Domains in SCOPe 2.08: d1tc6a_
  • Chain 'B':
    Compound: Endoplasmin
    Species: Canis lupus [TaxId:9615]
    Gene: TRA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tc6b_
  • Heterogens: MG, ADP, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tc6A (A:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tc6A (A:)
    fafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneeltvk
    ikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstseligqf
    gvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlkeea
    sdyleldtiknlvkkysqfinfpiyvwssktgktvwdwelmn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tc6B (B:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tc6B (B:)
    fqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneeltvkik
    cdkeknllhvtdtgvgmtreelvknltseligqfgvgfysaflvadkvivtskhnndtqh
    iwesdsnefsviadprgntlgrgttitlvlkeeasdyleldtiknlvkkysqfinfpiyv
    wsskttvwdwelmn