PDB entry 1tc5

View 1tc5 on RCSB PDB site
Description: Structural Analysis of a probable eukaryotic D-amino acid tRNA deacylase
Class: structural genomics, unknown function
Keywords: SGPP, STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Structural Genomics of Pathogenic Protozoa Consortium, UNKNOWN FUNCTION
Deposited on 2004-05-20, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.201
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable eukaryotic D-amino acid tRNA deacylase, LMAJ005534AAA
    Species: Leishmania major [TaxId:5664]
    Gene: L4171.5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tc5a1, d1tc5a2
  • Chain 'B':
    Compound: Probable eukaryotic D-amino acid tRNA deacylase, LMAJ005534AAA
    Species: Leishmania major [TaxId:5664]
    Gene: L4171.5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tc5b1, d1tc5b2
  • Chain 'C':
    Compound: Probable eukaryotic D-amino acid tRNA deacylase, LMAJ005534AAA
    Species: Leishmania major [TaxId:5664]
    Gene: L4171.5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tc5c1, d1tc5c2
  • Chain 'D':
    Compound: Probable eukaryotic D-amino acid tRNA deacylase, LMAJ005534AAA
    Species: Leishmania major [TaxId:5664]
    Gene: L4171.5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tc5d1, d1tc5d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tc5A (A:)
    mahhhhhhmtirvmlqamdqghllvnnvdkyvragrgvmvyiaflsdrdsapitdealrh
    avgvllhtkifthfspekminqpqsleecpemdilivpqaslggkvkgrsvqfhqlvakd
    vgaalydrfchfvrvargvdesrvdangaprsegdapkaegwikynsrvisgtfgnrqgl
    rfesegpfthmfdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tc5A (A:)
    hmtirvmlqamdqghllvnnvdkyvragrgvmvyiaflsdrdsapitdealrhavgvllh
    tkifthfspekminqpqsleecpemdilivpqaslggkvkgrsvqfhqlvakdvgaalyd
    rfchfvrvargvdesrvdangaprsegdapkaegwikynsrvisgtfgnrqglrfesegp
    fthmfdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tc5B (B:)
    mahhhhhhmtirvmlqamdqghllvnnvdkyvragrgvmvyiaflsdrdsapitdealrh
    avgvllhtkifthfspekminqpqsleecpemdilivpqaslggkvkgrsvqfhqlvakd
    vgaalydrfchfvrvargvdesrvdangaprsegdapkaegwikynsrvisgtfgnrqgl
    rfesegpfthmfdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tc5B (B:)
    hmtirvmlqamdqghllvnnvdkyvragrgvmvyiaflsdrdsapitdealrhavgvllh
    tkifthfspekminqpqsleecpemdilivpqaslggkvkgrsvqfhqlvakdvgaalyd
    rfchfvrvargvdesrvdangaprsegdapkaegwikynsrvisgtfgnrqglrfesegp
    fthmfdi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tc5C (C:)
    mahhhhhhmtirvmlqamdqghllvnnvdkyvragrgvmvyiaflsdrdsapitdealrh
    avgvllhtkifthfspekminqpqsleecpemdilivpqaslggkvkgrsvqfhqlvakd
    vgaalydrfchfvrvargvdesrvdangaprsegdapkaegwikynsrvisgtfgnrqgl
    rfesegpfthmfdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tc5C (C:)
    mtirvmlqamdqghllvnnvdkyvragrgvmvyiaflsdrdsapitdealrhavgvllht
    kifthfspekminqpqsleecpemdilivpqaslggkvkgrsvqfhqlvakdvgaalydr
    fchfvrvargvdesrvdangaprsegdapkaegwikynsrvisgtfgnrqglrfesegpf
    thmfdi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tc5D (D:)
    mahhhhhhmtirvmlqamdqghllvnnvdkyvragrgvmvyiaflsdrdsapitdealrh
    avgvllhtkifthfspekminqpqsleecpemdilivpqaslggkvkgrsvqfhqlvakd
    vgaalydrfchfvrvargvdesrvdangaprsegdapkaegwikynsrvisgtfgnrqgl
    rfesegpfthmfdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tc5D (D:)
    mtirvmlqamdqghllvnnvdkyvragrgvmvyiaflsdrdsapitdealrhavgvllht
    kifthfspekminqpqsleecpemdilivpqaslggkvkgrsvqfhqlvakdvgaalydr
    fchfvrvargvdesrvdangaprsegdapkaegwikynsrvisgtfgnrqglrfesegpf
    thmfdi