PDB entry 1tbw

View 1tbw on RCSB PDB site
Description: ligand induced conformational shift in the n-terminal domain of grp94, open conformation
Deposited on 2004-05-20, released 2004-08-24
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-24, with a file datestamp of 2004-08-24.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.22
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1tbwa_
  • Chain 'B':
    Domains in SCOP 1.71: d1tbwb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tbwA (A:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tbwA (A:)
    fafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneeltvk
    ikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqedgqstseligqf
    gvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrgttitlvlkeea
    sdyleldtiknlvkkysqfinfpiyvwssktgktvwdwelmn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tbwB (B:)
    gshmlreksekfafqaevnrmmkliinslyknkeiflrelisnasdaldkirlisltden
    alagneeltvkikcdkeknllhvtdtgvgmtreelvknlgtiaksgtseflnkmteaqed
    gqstseligqfgvgfysaflvadkvivtskhnndtqhiwesdsnefsviadprgntlgrg
    ttitlvlkeeasdyleldtiknlvkkysqfinfpiyvwssktggggktvwdwelmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tbwB (B:)
    qaevnrmmkliinslyknkeiflrelisnasdaldkirlisltdenalagneeltvkikc
    dkeknllhvtdtgvgmtreelvknlstseligqfgvgfysaflvadkvivtskhnndtqh
    iwesdsnefsviadprgntlgrgttitlvlkeeasdyleldtiknlvkkysqfinfpiyv
    wsskgktvwdwelmn