PDB entry 1tbr

View 1tbr on RCSB PDB site
Description: crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin
Deposited on 1995-03-03, released 1996-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1996-10-14, with a file datestamp of 1996-10-15.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.189
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tbrH (H:)
    ivegqdaevglspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddll
    vrigkhsrtryerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvcl
    pdkqtaakllhagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastrir
    itdnmfcagykpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidrlgs
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tbrJ (J:)
    tsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegr
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tbrK (K:)
    ivegqdaevglspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddll
    vrigkhsrtryerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvcl
    pdkqtaakllhagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastrir
    itdnmfcagykpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidrlgs
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tbrL (L:)
    tsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegr
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tbrR (R:)
    eggepcacphalhrvcgsdgetysnpctlncakfngkpelvkvhdgpcepdededvcqec
    dgdeykpvcgsdditydnncrlecasissspgvelkhegpcrt
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tbrS (S:)
    eggepcacphalhrvcgsdgetysnpctlncakfngkpelvkvhdgpcepdededvcqec
    dgdeykpvcgsdditydnncrlecasissspgvelkhegpcrt