PDB entry 1tbp

View 1tbp on RCSB PDB site
Description: crystal structure of yeast tata-binding protein and model for interaction with DNA
Class: binding protein
Keywords: binding protein
Deposited on 1993-08-02, released 1994-01-31
The last revision prior to the SCOP 1.73 freeze date was dated 1994-01-31, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 2.6 Å
R-factor: 0.211
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tata-binding protein
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1tbpa1, d1tbpa2
  • Chain 'B':
    Compound: tata-binding protein
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1tbpb1, d1tbpb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tbpA (A:)
mgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tbpB (B:)
mgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm