PDB entry 1tbp

View 1tbp on RCSB PDB site
Description: crystal structure of yeast tata-binding protein and model for interaction with dna
Deposited on 1993-08-02, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.6 Å
R-factor: 0.211
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tbpA (A:)
    sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
    mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
    tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tbpA (A:)
    mgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
    mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
    tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tbpB (B:)
    sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
    mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
    tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tbpB (B:)
    mgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
    mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
    tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm