PDB entry 1tbo

View 1tbo on RCSB PDB site
Description: nmr structure of a protein kinase c-g phorbol-binding domain, 30 structures
Class: calcium-binding protein
Keywords: calcium-binding protein, protein kinase c, pkc, transferase
Deposited on 1997-04-15, released 1998-04-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein kinase c, gamma type
  Species: Rattus rattus [TaxId:10117]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05697
  Domains in SCOPe 2.06: d1tboa_
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1tboA (A:)
  gpqtddprnkhkfrlhsyssptfcdhcgsllyglvhqgmkcsccemnvhrrcvrsvpslc
  gvdhterrgrlqleiraptsde
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1tboA (A:)
  qtddprnkhkfrlhsyssptfcdhcgsllyglvhqgmkcsccemnvhrrcvrsvpslcgv
  dhterr