PDB entry 1tbo

View 1tbo on RCSB PDB site
Description: nmr structure of a protein kinase c-g phorbol-binding domain, 30 structures
Deposited on 1997-04-15, released 1998-04-29
The last revision prior to the SCOP 1.55 freeze date was dated 1998-04-29, with a file datestamp of 1998-04-29.
Experiment type: NMR30
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1tbo__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tbo_ (-)
    qtddprnkhkfrlhsyssptfcdhcgsllyglvhqgmkcsccemnvhrrcvrsvpslcgv
    dhterr