PDB entry 1tbd

View 1tbd on RCSB PDB site
Description: solution structure of the origin DNA binding domain of sv40 t-antigen, nmr, minimized average structure
Class: DNA-binding protein
Keywords: DNA-binding protein, replication origin binding domain
Deposited on 1996-11-04, released 1997-03-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sv40 t-antigen
    Species: Simian virus 40 [TaxId:10633]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1tbda1, d1tbda2, d1tbda3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tbdA (A:)
    gskvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhn
    synhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieesl
    pgglkehdfnpess