PDB entry 1tbd

View 1tbd on RCSB PDB site
Description: solution structure of the origin DNA binding domain of sv40 t-antigen, nmr, minimized average structure
Class: DNA-binding protein
Keywords: DNA-binding protein, replication origin binding domain
Deposited on 1996-11-04, released 1997-03-12
The last revision prior to the SCOP 1.73 freeze date was dated 1997-03-12, with a file datestamp of 2007-06-04.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sv40 t-antigen
    Species: Simian virus 40
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1tbda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tbdA (A:)
gskvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhn
synhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieesl
pgglkehdfnpess