PDB entry 1tbd

View 1tbd on RCSB PDB site
Description: solution structure of the origin dna binding domain of sv40 t-antigen, nmr, minimized average structure
Deposited on 1996-11-04, released 1997-03-12
The last revision prior to the SCOP 1.71 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1tbd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tbd_ (-)
    gskvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhn
    synhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieesl
    pgglkehdfnpess