PDB entry 1tbb

View 1tbb on RCSB PDB site
Description: Catalytic Domain Of Human Phosphodiesterase 4D In Complex With Rolipram
Class: hydrolase
Keywords: pde4d, hydrolase
Deposited on 2004-05-19, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.187
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tbba_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tbbb_
  • Heterogens: ZN, MG, ROL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tbbA (A:)
    gshmteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdt
    litylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihd
    vdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslr
    kmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsn
    ptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplw
    etwadlvhpdaqdildtlednrewyqstipqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tbbA (A:)
    qedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylm
    tledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgv
    snqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidi
    vlatdmskhmnlladlktmvetkkvtvllldnysdriqvlqnmvhcadlsnptkplqlyr
    qwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadlvhp
    daqdildtlednrewyqstip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tbbB (B:)
    gshmteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdt
    litylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihd
    vdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslr
    kmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsn
    ptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplw
    etwadlvhpdaqdildtlednrewyqstipqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tbbB (B:)
    eqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlityl
    mtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpg
    vsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvid
    ivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkpl
    qlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwad
    lvhpdaqdildtlednrewyqstipq