PDB entry 1tba

View 1tba on RCSB PDB site
Description: solution structure of a tbp-tafii230 complex: protein mimicry of the minor groove surface of the tata box unwound by tbp, nmr, 25 structures
Class: complex (transcription factors)
Keywords: complex (transcription factors), tbp, taf, tafii230, tfiid, nmr, solution structure
Deposited on 1998-08-16, released 1999-08-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription initiation factor iid 230k chain
    Species: Drosophila melanogaster [TaxId:7227]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1tbaa_
  • Chain 'B':
    Compound: Transcription initiation factor TFIID
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1tbab1, d1tbab2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tbaA (A:)
    egsigngldltgilfgnidsegrllqdddgegrggtgfdaelrenigslsklgldsmlle
    vidlkea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tbaB (B:)
    sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
    mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
    tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm