PDB entry 1tba

View 1tba on RCSB PDB site
Description: solution structure of a tbp-tafii230 complex: protein mimicry of the minor groove surface of the tata box unwound by tbp, nmr, 25 structures
Class: complex (transcription factors)
Keywords: complex (transcription factors), tbp, taf, tafii230, tfiid, nmr, solution structure
Deposited on 1998-08-16, released 1999-08-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transcription initiation factor iid 230k chain
  Species: Drosophila melanogaster [TaxId:7227]
  Gene:
  Database cross-references and differences (RAF-indexed):
  • Uniprot P51123 (0-66)
  Domains in SCOPe 2.05: d1tbaa_
• Chain 'B':
  Compound: Transcription initiation factor TFIID
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene:
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13393 (0-179)
  Domains in SCOPe 2.05: d1tbab1, d1tbab2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tbaA (A:)
  egsigngldltgilfgnidsegrllqdddgegrggtgfdaelrenigslsklgldsmlle
  vidlkea
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tbaB (B:)
  sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
  mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
  tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm