PDB entry 1tba

View 1tba on RCSB PDB site
Description: solution structure of a tbp-tafii230 complex: protein mimicry of the minor groove surface of the tata box unwound by tbp, nmr, 25 structures
Deposited on 1998-08-16, released 1999-08-16
The last revision prior to the SCOP 1.71 freeze date was dated 1999-08-16, with a file datestamp of 1999-08-15.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tbaA (A:)
egsigngldltgilfgnidsegrllqdddgegrggtgfdaelrenigslsklgldsmlle
vidlkea

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tbaB (B:)
sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm