PDB entry 1tb5

View 1tb5 on RCSB PDB site
Description: Catalytic Domain Of Human Phosphodiesterase 4B In Complex With AMP
Deposited on 2004-05-19, released 2004-08-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-03, with a file datestamp of 2004-08-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.235
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1tb5a_
  • Chain 'B':
    Domains in SCOP 1.69: d1tb5b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tb5A (A:)
    gshmsisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllk
    tfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaa
    ifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnlt
    kkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnm
    vhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfi
    dyivhplwetwadlvqpdaqdildtlednrnwyqsmipqspsppldeqnrdcqglmekfq
    feltldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tb5A (A:)
    edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
    ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
    nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
    latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
    yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
    qpdaqdildtlednrnwyqsmip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tb5B (B:)
    gshmsisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllk
    tfrissdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaa
    ifaaaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnlt
    kkqrqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnm
    vhcadlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfi
    dyivhplwetwadlvqpdaqdildtlednrnwyqsmipqspsppldeqnrdcqglmekfq
    feltldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tb5B (B:)
    edhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfrissdtfitymmt
    ledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaaaihdvdhpgvs
    nqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqrqtlrkmvidmv
    latdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhcadlsnptkslel
    yrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyivhplwetwadlv
    qpdaqdildtlednrnwyqsmip