PDB entry 1tb3

View 1tb3 on RCSB PDB site
Description: Crystal Structure Analysis of Recombinant Rat Kidney Long-chain Hydroxy Acid Oxidase
Class: oxidoreductase
Keywords: long chain alpha-hydroxy acid oxidase, flavoprotein, oxidase, OXIDOREDUCTASE
Deposited on 2004-05-19, released 2005-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.239
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydroxyacid oxidase 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: HAO3, HAOX3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tb3a1
  • Chain 'B':
    Compound: Hydroxyacid oxidase 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: HAO3, HAOX3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tb3b_
  • Chain 'C':
    Compound: Hydroxyacid oxidase 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: HAO3, HAOX3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tb3c_
  • Chain 'D':
    Compound: Hydroxyacid oxidase 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: HAO3, HAOX3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tb3d_
  • Chain 'E':
    Compound: Hydroxyacid oxidase 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: HAO3, HAOX3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tb3e_
  • Chain 'F':
    Compound: Hydroxyacid oxidase 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: HAO3, HAOX3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tb3f_
  • Chain 'G':
    Compound: Hydroxyacid oxidase 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: HAO3, HAOX3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tb3g_
  • Chain 'H':
    Compound: Hydroxyacid oxidase 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: HAO3, HAOX3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tb3h_
  • Heterogens: FMN, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tb3A (A:)
    plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
    ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
    egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnleanill
    kdlralkeekptqsvpvsfpkasfcwndlsllqsitrlpiilkgiltkedaelamkhnvq
    givvsnhggrqldevsasidalrevvaavkgkievymdggvrtgtdvlkalalgarcifl
    grpilwglackgedgvkevldiltaelhrcmtlsgcqsvaeispdliqfsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tb3A (A:)
    plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
    ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
    egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnleakdlr
    alkeasfcwndlsllqsitrlpiilkgiltkedaelamkhnvqgivvsnhggrqldevsa
    sidalrevvaavkgkievymdggvrtgtdvlkalalgarciflgrpilwglackgedgvk
    evldiltaelhrcmtlsgcqsvaeispdliqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1tb3B (B:)
    plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
    ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
    egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnleanill
    kdlralkeekptqsvpvsfpkasfcwndlsllqsitrlpiilkgiltkedaelamkhnvq
    givvsnhggrqldevsasidalrevvaavkgkievymdggvrtgtdvlkalalgarcifl
    grpilwglackgedgvkevldiltaelhrcmtlsgcqsvaeispdliqfsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tb3B (B:)
    plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
    ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
    egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnleaalka
    sfcwndlsllqsitrlpiilkgiltkedaelamkhnvqgivvsnhggrqldevsasidal
    revvaavkgkievymdggvrtgtdvlkalalgarciflgrpilwglackgedgvkevldi
    ltaelhrcmtlsgcqsvaeispdliqf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1tb3C (C:)
    plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
    ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
    egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnleanill
    kdlralkeekptqsvpvsfpkasfcwndlsllqsitrlpiilkgiltkedaelamkhnvq
    givvsnhggrqldevsasidalrevvaavkgkievymdggvrtgtdvlkalalgarcifl
    grpilwglackgedgvkevldiltaelhrcmtlsgcqsvaeispdliqfsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tb3C (C:)
    plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
    ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
    egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnleakdlr
    alkeasfcwndlsllqsitrlpiilkgiltkedaelamkhnvqgivvsnhggrqldevsa
    sidalrevvaavkgkievymdggvrtgtdvlkalalgarciflgrpilwglackgedgvk
    evldiltaelhrcmtlsgcqsvaeispdliqf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1tb3D (D:)
    plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
    ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
    egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnleanill
    kdlralkeekptqsvpvsfpkasfcwndlsllqsitrlpiilkgiltkedaelamkhnvq
    givvsnhggrqldevsasidalrevvaavkgkievymdggvrtgtdvlkalalgarcifl
    grpilwglackgedgvkevldiltaelhrcmtlsgcqsvaeispdliqfsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tb3D (D:)
    plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
    ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
    egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnlealral
    kasfcwndlsllqsitrlpiilkgiltkedaelamkhnvqgivvsnhggrqldevsasid
    alrevvaavkgkievymdggvrtgtdvlkalalgarciflgrpilwglackgedgvkevl
    diltaelhrcmtlsgcqsvaeispdliqf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1tb3E (E:)
    plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
    ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
    egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnleanill
    kdlralkeekptqsvpvsfpkasfcwndlsllqsitrlpiilkgiltkedaelamkhnvq
    givvsnhggrqldevsasidalrevvaavkgkievymdggvrtgtdvlkalalgarcifl
    grpilwglackgedgvkevldiltaelhrcmtlsgcqsvaeispdliqfsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tb3E (E:)
    plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
    ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
    egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnleaasfc
    wndlsllqsitrlpiilkgiltkedaelamkhnvqgivvsnhggrqldevsasidalrev
    vaavkgkievymdggvrtgtdvlkalalgarciflgrpilwglackgedgvkevldilta
    elhrcmtlsgcqsvaeispdliqf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1tb3F (F:)
    plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
    ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
    egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnleanill
    kdlralkeekptqsvpvsfpkasfcwndlsllqsitrlpiilkgiltkedaelamkhnvq
    givvsnhggrqldevsasidalrevvaavkgkievymdggvrtgtdvlkalalgarcifl
    grpilwglackgedgvkevldiltaelhrcmtlsgcqsvaeispdliqfsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tb3F (F:)
    plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
    ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
    egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnleakdlr
    alkeasfcwndlsllqsitrlpiilkgiltkedaelamkhnvqgivvsnhggrqldevsa
    sidalrevvaavkgkievymdggvrtgtdvlkalalgarciflgrpilwglackgedgvk
    evldiltaelhrcmtlsgcqsvaeispdliqf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1tb3G (G:)
    plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
    ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
    egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnleanill
    kdlralkeekptqsvpvsfpkasfcwndlsllqsitrlpiilkgiltkedaelamkhnvq
    givvsnhggrqldevsasidalrevvaavkgkievymdggvrtgtdvlkalalgarcifl
    grpilwglackgedgvkevldiltaelhrcmtlsgcqsvaeispdliqfsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tb3G (G:)
    plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
    ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
    egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnlearalk
    easfcwndlsllqsitrlpiilkgiltkedaelamkhnvqgivvsnhggrqldevsasid
    alrevvaavkgkievymdggvrtgtdvlkalalgarciflgrpilwglackgedgvkevl
    diltaelhrcmtlsgcqsvaeispdliqf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1tb3H (H:)
    plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
    ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
    egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnleanill
    kdlralkeekptqsvpvsfpkasfcwndlsllqsitrlpiilkgiltkedaelamkhnvq
    givvsnhggrqldevsasidalrevvaavkgkievymdggvrtgtdvlkalalgarcifl
    grpilwglackgedgvkevldiltaelhrcmtlsgcqsvaeispdliqfsrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tb3H (H:)
    plvcladfkahaqkqlsktswdfiegeaddgityseniaafkrirlrprylrdmskvdtr
    ttiqgqeisapicisptafhsiawpdgekstaraaqeanicyvissyasysledivaaap
    egfrwfqlymksdwdfnkqmvqraealgfkalvitidtpvlgnrrrdkrnqlnleakdlr
    alkeasfcwndlsllqsitrlpiilkgiltkedaelamkhnvqgivvsnhggrqldevsa
    sidalrevvaavkgkievymdggvrtgtdvlkalalgarciflgrpilwglackgedgvk
    evldiltaelhrcmtlsgcqsvaeispdliqf