PDB entry 1taw

View 1taw on RCSB PDB site
Description: bovine trypsin complexed to appi
Class: complex (serine protease/inhibitor)
Keywords: serine protease, kunitz type inhibitor, complex, protease-substrate interactions, complex (serine protease-inhibitor) complex
Deposited on 1996-12-19, released 1997-06-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00760 (0-222)
      • conflict (144)
    Domains in SCOPe 2.08: d1tawa_
  • Chain 'B':
    Compound: protease inhibitor domain of alzheimer's amyloid beta-protein precursor
    Species: Homo sapiens [TaxId:9606]
    Gene: A4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1tawb_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1tawA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilstsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1tawB (B:)
vrevcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcgsa

    Sequence, based on observed residues (ATOM records): (download) 
    >1tawB (B:)
evcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg