PDB entry 1taq

View 1taq on RCSB PDB site
Description: structure of taq DNA polymerase
Class: nucleotidyltransferase
Keywords: taq DNA polymerase, pcr polymerase, nucleotidyltransferase
Deposited on 1996-06-04, released 1996-12-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.202
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: taq DNA polymerase
    Species: Thermus aquaticus [TaxId:271]
    Gene: TAQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19821 (Start-831)
      • conflict (574-576)
      • conflict (596)
    Domains in SCOPe 2.04: d1taqa1, d1taqa2, d1taqa3, d1taqa4
  • Heterogens: BGL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1taqA (A:)
    mrgmlplfepkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgd
    avivvfdakapsfrheayggykagraptpedfprqlalikelvdllglarlevpgyeadd
    vlaslakkaekegyevriltadkdlyqllsdrihvlhpegylitpawlwekyglrpdqwa
    dyraltgdesdnlpgvkgigektarklleewgsleallknldrlkpairekilahmddlk
    lswdlakvrtdlplevdfakrrepdrerlraflerlefgsllhefgllespkaleeapwp
    ppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkeargllakdlsvla
    lreglglppgddpmllaylldpsnttpegvarryggewteeageraalserlfanlwgrl
    egeerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlagh
    pfnlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltk
    lkstyidplpdlihprtgrlhtrfnqtatatgrlcccdpnlqnipvrtplgqrirrgfia
    eegwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrr
    aaktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyv
    etlfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgarml
    lqvhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake
    

    Sequence, based on observed residues (ATOM records): (download)
    >1taqA (A:)
    pkgrvllvdghhlayrtfhalkglttsrgepvqavygfaksllkalkedgdavivvfdar
    aptpedfprqlalikelvdllglarlevpgyeaddvlaslakkaekegyevriltadkdl
    yqllsdrihvlhpegylitpawlwekyglrpdqwadyraltgdesdnlpgvkgigektar
    klleewgsleallknldrlkpairekilahmddlklswdlakvrtdlplevdfakrrepd
    rerlraflerlefgsllhefgllespkaleeapwpppegafvgfvlsrkepmwadllala
    aarggrvhrapepykalrdlkeargllakdlsvlalreglglppgddpmllaylldpsnt
    tpegvarryggewteeageraalserlfanlwgrlegeerllwlyreverplsavlahme
    atgvrldvaylralslevaeeiarleaevfrlaghpfnlnsrdqlervlfdelglpaigk
    tektgkrstsaavlealreahpivekilqyreltklkstyidplpdlihprtgrlhtrfn
    qtatatgrlcccdpnlqnipvrtplgqrirrgfiaeegwllvaldysqielrvlahlsgd
    enlirvfqegrdihtetaswmfgvpreavdplmrraaktinfgvlygmsahrlsqelaip
    yeeaqafieryfqsfpkvrawiektleegrrrgyvetlfgrrryvpdlearvksvreaae
    rmafnmpvqgtaadlmklamvklfprleemgarmllqvhdelvleapkeraeavarlake
    vmegvyplavplevevgigedwlsake