PDB entry 1tam

View 1tam on RCSB PDB site
Description: human immunodeficiency virus, nmr, minimized average structure
Class: matrix protein
Keywords: aids, core protein, polyprotein, myristylation, phosphorylation, matrix protein
Deposited on 1996-02-07, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 matrix protein
    Species: HIV-1 M:B_HXB2R [TaxId:11706]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1tama_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1tamA (A:)
    mgarasvlsggeldrwekirlrpggkkkyklkhivwasrelerfavnpglletsegcrqi
    lgqlqpslqtgseelrslyntvatlycvhqrieikdtkealdkieeeqnkskkkaqqaaa
    dtghssqvsqny
    

    Sequence, based on observed residues (ATOM records): (download)
    >1tamA (A:)
    mgarasvlsggeldrwekirlrpggkkkyklkhivwasrelerfavnpglletsegcrqi
    lgqlqpslqtgseelrslyntvatlycvhqrieikdtkealdkieeeqnkskkkaqqaaa