PDB entry 1taf

View 1taf on RCSB PDB site
Description: drosophila tbp associated factors dtafii42/dtafii62 heterotetramer
Class: complex (two transcription factors)
Keywords: transcription initiation, histone fold, complex (two transcription factors)
Deposited on 1996-06-01, released 1996-12-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tfiid tbp associated factor 42
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27272 (0-67)
      • engineered (36)
    Domains in SCOPe 2.05: d1tafa_
  • Chain 'B':
    Compound: tfiid tbp associated factor 62
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1tafb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tafA (A:)
    pkdaqvimsilkelnvqeyeprvvnqlleftfryvtsilddakvyanharkktidlddvr
    latevtld
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tafB (B:)
    mlygssisaesmkviaesigvgslsddaakelaedvsiklkrivqdaakfmnhakrqkls
    vrdidmslkv