PDB entry 1taf

View 1taf on RCSB PDB site
Description: drosophila tbp associated factors dtafii42/dtafii62 heterotetramer
Class: complex (two transcription factors)
Keywords: transcription initiation, histone fold, complex (two transcription factors)
Deposited on 1996-06-01, released 1996-12-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.198
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: tfiid tbp associated factor 42
  Species: Drosophila melanogaster [TaxId:7227]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q27272 (0-67)
    • engineered (36)
  Domains in SCOPe 2.04: d1tafa_
• Chain 'B':
  Compound: tfiid tbp associated factor 62
  Species: Drosophila melanogaster [TaxId:7227]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49847 (0-69)
  Domains in SCOPe 2.04: d1tafb_
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tafA (A:)
  pkdaqvimsilkelnvqeyeprvvnqlleftfryvtsilddakvyanharkktidlddvr
  latevtld
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1tafB (B:)
  mlygssisaesmkviaesigvgslsddaakelaedvsiklkrivqdaakfmnhakrqkls
  vrdidmslkv